| Protein or peptide name: | ScRYMV |
| Chromosome: | Rice yellow mottle virus satellite, complete genome |
| Protein or peptide start site: | 3 |
| Protein or peptide end site: | 218 |
| ncRNA start site: | 3 |
| ncRNA end site: | 218 |
| Genome Browser: | NA |
| Protein or peptide sequence: | MKETAAAKFERQHMDSPDLGTLVPRGSMGYLWIRIRARYPGRPGRLGAVHRASLWSEPGLQGAWRRNRSVGTTRTISHRAPAASSCAGGGDFVSSLTDTDEPRGTWRHPGISPGSTWAARSRAQGVAVERAWPPRGLEAKPVCWDHSDHQSSCSGSFQLRRGRRFCFEPYRHAKRNLEAPRNFTRVDLGGEPCTGRRCGASLASKGPGGETGLLGPLGPSVIVLRQL |
| Protein or peptide length: | 227aa |
| ncRNA type: | circRNA |
| ncRNA name: | scRYMV |
| Entrez ID: | 932238 |
| Experimental species: | rice yellow mottle virus (sobemovirus) |
| Experimental techniques: | MS/Western blotting/Immunoprecipitation |
| Experimental sample (cell line and/or tissue): | E. coli |
| Description: | The highly structured (64% GC) covalently closed circular (CCC) RNA (220 nt) of the virusoid associated with rice yellow mottle virus codes for a 16-kDa highly basic protein using novel modalities for coding, translation, and gene expression. |
| Subcellular location: | NA |
| Function: | This CCC RNA is the smallest among all known viroids and virusoids and the only one that codes proteins. |
| Title of paper: | Novel coding, translation, and gene expression of a replicating covalently closed circular RNA of 220 nt |
| PMID: | 25253891 |
| Year of publication: | 2014 |
